{"product_id":"proteintech-12069-1-ap","title":"Proteintech, 12069-1-AP, NBL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NBL1 (12069-1-AP) by Proteintech is a Polyclonal antibody targeting NBL1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12069-1-AP targets NBL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNBL1 (neuroblastoma suppression of tumorigenicity 1), also named as DAN, is the founding member of the DAN subfamily. It was originally identified as a putative tumor suppressor gene in a transformed fibroblast rat model (PMID: 9516839), whereby it was significantly down-regulated in v-src-transformed rat fibroblasts. The MW of this protein is 19 kDa, and this antibody specially recognises the 19 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2706 Product name: Recombinant human NBL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-180 aa of BC012037 Sequence: LALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED Predict reactive species\nFull Name: neuroblastoma, suppression of tumorigenicity 1\nCalculated Molecular Weight: 180 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC012037\nGene Symbol: NBL1\nGene ID (NCBI): 4681\nRRID: AB_10638604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41271\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887732969641,"sku":"12069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12069-1-ap","provider":"Iright","version":"1.0","type":"link"}