{"product_id":"proteintech-12091-1-ap","title":"Proteintech, 12091-1-AP, G0S2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe G0S2 (12091-1-AP) by Proteintech is a Polyclonal antibody targeting G0S2 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12091-1-AP targets G0S2 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: H9C2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG0S2 is G0\/G1 switch protein 2. It is an all trans- retinoic acid (RA) target gene. G0S2 promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2731 Product name: Recombinant human G0S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC009694 Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS Predict reactive species\nFull Name: G0\/G1switch 2\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: BC009694\nGene Symbol: G0S2\nGene ID (NCBI): 50486\nRRID: AB_2877824\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27469\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881801385,"sku":"12091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12091-1-ap","provider":"Iright","version":"1.0","type":"link"}