{"product_id":"proteintech-12096-1-ap","title":"Proteintech, 12096-1-AP, DNAJC19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC19 (12096-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC19 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12096-1-AP targets DNAJC19 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  human brain tissue,  human lung tissue\nPositive IP detected in: mouse heart tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJC19 is a mitochondrial cochaperone that interacts with HSP70 chaperones through its conserved J-domain. As a transmembrane protein, DNAJC19 is strongly associated with the inner mitochondrial membrane. Mutations in DNAJC19 cause dilated cardiomyopathy with ataxia (DCMA). Recently DNAJC19 has been reported as interactor of PHB complex to regulate cardiolipin remodeling, which addressed the link of DNAJC19 to cardiomyopathy. This antibody is specific to DNAJC19 and had been tested by siRNA.(24856930)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2739 Product name: Recombinant human DNAJC19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC009702 Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 19\nCalculated Molecular Weight: 116 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC009702\nGene Symbol: DNAJC19\nGene ID (NCBI): 131118\nRRID: AB_2094914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940390569,"sku":"12096-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12096-1-ap","provider":"Iright","version":"1.0","type":"link"}