{"product_id":"proteintech-12107-1-ap","title":"Proteintech, 12107-1-AP, BCOR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCOR (12107-1-AP) by Proteintech is a Polyclonal antibody targeting BCOR in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12107-1-AP targets BCOR in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1\/nervous system polycomb1 (PCGF1\/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2752 Product name: Recombinant human BCOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-361 aa of BC009675 Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW Predict reactive species\nFull Name: BCL6 co-repressor\nCalculated Molecular Weight: 1703 aa, 186 kDa\nObserved Molecular Weight: 186 kDa\nGenBank Accession Number: BC009675\nGene Symbol: BCOR\nGene ID (NCBI): 54880\nRRID: AB_2290335\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6W2J9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910407849,"sku":"12107-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12107-1-ap","provider":"Iright","version":"1.0","type":"link"}