{"product_id":"proteintech-12119-1-ap","title":"Proteintech, 12119-1-AP, LRDD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRDD (12119-1-AP) by Proteintech is a Polyclonal antibody targeting LRDD in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12119-1-AP targets LRDD in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  L02 cells\nPositive IP detected in: L02 cells\nPositive IHC detected in: human lung tissue, human pancreas tissue,  human liver tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nP53-induced protein with a death domain (PIDD\/LRDD) is a component of the PIDDosome. PIDD contains 910 residues with 7 leucine rich repeats (LRRs), 2 ZU-5 domains and a C-terminal death domain (DD). PIDD can be cleaved into shorter fragments generating a PIDD-N fragment of 48 kD (residues 1-446), a PIDD-C fragment of 51 kD (residues 447-910) and a PIDD-CC fragment of 37 kD (residues 589-910). Auto-cleavage of PIDD determines the downstream signaling events. The PIDD-C fragment mediates activation of NFκB via the recruitment of RIP1 and NEMO, while PIDD-CC causes caspase-2 activation, which leads to apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2761 Product name: Recombinant human LRDD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC014904 Sequence: MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACGVRLQFPAGAT Predict reactive species\nFull Name: leucine-rich repeats and death domain containing\nCalculated Molecular Weight: 893 aa, 98 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC014904\nGene Symbol: LRDD\nGene ID (NCBI): 55367\nRRID: AB_10694424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HB75\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555478697,"sku":"12119-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12119-1-ap","provider":"Iright","version":"1.0","type":"link"}