{"product_id":"proteintech-12120-1-ap","title":"Proteintech, 12120-1-AP, SLC16A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC16A5 (12120-1-AP) by Proteintech is a Polyclonal antibody targeting SLC16A5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n12120-1-AP targets SLC16A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human placenta tissue\nPositive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMonocarboxylate transporter 5 (SLC16A5), also named as MCT6, is a member of the MCT family. SLC16A5 is a proton-linked monocarboxylate transporter that catalyzes the rapid transport across the plasma membrane of many monocarboxylates and it can transport various drugs. It has been reported that SLC16A5 mutation may be a novel genetic risk factor for cisplatin-induced ototoxic (CIO) in testicular cancer patients. There are some isoforms of SLC16A5 among 50-55 kDa. (PMID: 16174808, 28448657)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2762 Product name: Recombinant human SLC16A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-505 aa of BC009684 Sequence: ALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT Predict reactive species\nFull Name: solute carrier family 16, member 5 (monocarboxylic acid transporter 6)\nCalculated Molecular Weight: 505 aa, 55 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC009684\nGene Symbol: SLC16A5\nGene ID (NCBI): 9121\nRRID: AB_2877827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15375\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803781289,"sku":"12120-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12120-1-ap","provider":"Iright","version":"1.0","type":"link"}