{"product_id":"proteintech-12122-1-ap","title":"Proteintech, 12122-1-AP, TSPAN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN5 (12122-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN5 in WB, IHC, ELISA applications with reactivity to human samples\n12122-1-AP targets TSPAN5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN5 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN5 belongs to the TSPANC8 subfamily, which also include TSPAN10, TSPAN14, TSPAN15, TSPAN17, and TSPAN33. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2765 Product name: Recombinant human TSPAN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-240 aa of BC009704 Sequence: DWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF Predict reactive species\nFull Name: tetraspanin 5\nCalculated Molecular Weight: 268 aa, 30 kDa\nObserved Molecular Weight: 30-40 kDa, 90 kDa\nGenBank Accession Number: BC009704\nGene Symbol: TSPAN5\nGene ID (NCBI): 10098\nRRID: AB_10638611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62079\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869623963817,"sku":"12122-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12122-1-ap","provider":"Iright","version":"1.0","type":"link"}