{"product_id":"proteintech-12124-2-ap","title":"Proteintech, 12124-2-AP, WSB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WSB2 (12124-2-AP) by Proteintech is a Polyclonal antibody targeting WSB2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12124-2-AP targets WSB2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, rat kidney tissue,  mouse kidney tissue,  human brain tissue\nPositive IP detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWSB2, also named SBA2, encodes WD repeat and SOCS box-containing protein 2. WSB2 may be a substrate-recognition component of an E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. WSB2 is a novel protein supposed to be involved in male- and female-specific gonadal development, and also a regulator of IL-21 receptor expression and IL21-induced signal transduction. WSB2 might be a promising novel biomarker of cell differentiation in colorectal cancer and its biological functions need further studies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2768 Product name: Recombinant human WSB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC015887 Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF Predict reactive species\nFull Name: WD repeat and SOCS box-containing 2\nCalculated Molecular Weight: 404 aa, 45 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC015887\nGene Symbol: WSB2\nGene ID (NCBI): 55884\nRRID: AB_2216206\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYS7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869440692393,"sku":"12124-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12124-2-ap","provider":"Iright","version":"1.0","type":"link"}