{"product_id":"proteintech-12125-1-ap","title":"Proteintech, 12125-1-AP, RAB22A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB22A (12125-1-AP) by Proteintech is a Polyclonal antibody targeting RAB22A in WB, IP, IHC, ELISA applications with reactivity to human samples\n12125-1-AP targets RAB22A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Jurkat cells,  BxPC-3 cells,  A375 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB22A is a small GTPase that is expressed ubiquitously in mammalian tissues. It localizes in the MHCI-containing recycling endosomal tubules and functions in endocytic pathway. RAB22A may regulate the dynamic interactions of endosomal compartments and it may be involved in the communication between the biosynthetic and early endocytic pathways. It shares 81% identity with RAB31.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, canine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2769 Product name: Recombinant human RAB22A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC015710 Sequence: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC Predict reactive species\nFull Name: RAB22A, member RAS oncogene family\nCalculated Molecular Weight: 194 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC015710\nGene Symbol: RAB22A\nGene ID (NCBI): 57403\nRRID: AB_2173765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UL26\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868866564265,"sku":"12125-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12125-1-ap","provider":"Iright","version":"1.0","type":"link"}