{"product_id":"proteintech-12136-1-ap","title":"Proteintech, 12136-1-AP, NXT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NXT2 (12136-1-AP) by Proteintech is a Polyclonal antibody targeting NXT2 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n12136-1-AP targets NXT2 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNXT2 is a member of NXT family proteins that are generally involved in exporting nuclear RNA in eukaryotic cells. The function of NXT2 has not been widely studied, and is yet to be fully elucidated.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2782 Product name: Recombinant human NXT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-197 aa of BC014888 Sequence: TREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS Predict reactive species\nFull Name: nuclear transport factor 2-like export factor 2\nCalculated Molecular Weight: 197 aa, 23 kDa\nGenBank Accession Number: BC014888\nGene Symbol: NXT2\nGene ID (NCBI): 55916\nRRID: AB_2158284\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPJ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744700585,"sku":"12136-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12136-1-ap","provider":"Iright","version":"1.0","type":"link"}