{"product_id":"proteintech-12143-1-ap","title":"Proteintech, 12143-1-AP, p63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe p63 (12143-1-AP) by Proteintech is a Polyclonal antibody targeting p63 in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n12143-1-AP targets p63 in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human heart tissue,  mouse heart tissue,  U-937 cells,  Apoptosised HeLa cells,  HaCaT cells,  PC-12 cells,  mouse thymus tissue\nPositive IP detected in: A431 cells\nPositive IHC detected in: human lung cancer tissue, human bowen disease tissue,  human prostate cancer tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTP63, also named KET, P63, P73H, P73L and TP73L, belongs to the p53 family. It is a homologue of the tumor suppressor p53 and p73 genes. It is involved in malignancy acquisition and maintenance of cells. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis. TP63 acts as a sequence specific DNA binding transcriptional activator or repressor. TP63 has 12 isoforms with MW 40kd(P40), 50kd(P60),63kd(P63) and 73kd(P73L).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2791 Product name: Recombinant human TP63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-680 aa of BC039815 Sequence: NTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE Predict reactive species\nFull Name: tumor protein p63\nCalculated Molecular Weight: 680 aa, 77 kDa\nObserved Molecular Weight: 63-68 kDa\nGenBank Accession Number: BC039815\nGene Symbol: TP63\nGene ID (NCBI): 8626\nRRID: AB_10597397\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3D4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843462825,"sku":"12143-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12143-1-ap","provider":"Iright","version":"1.0","type":"link"}