{"product_id":"proteintech-12162-1-ap","title":"Proteintech, 12162-1-AP, RAB39B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB39B (12162-1-AP) by Proteintech is a Polyclonal antibody targeting RAB39B in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n12162-1-AP targets RAB39B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  Y79 cells,  human brain tissue\nPositive IP detected in: SH-SY5Y cells, mouse brain tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2803 Product name: Recombinant human RAB39B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC009714 Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC Predict reactive species\nFull Name: RAB39B, member RAS oncogene family\nCalculated Molecular Weight: 213 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC009714\nGene Symbol: RAB39B\nGene ID (NCBI): 116442\nRRID: AB_2177360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920467625,"sku":"12162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12162-1-ap","provider":"Iright","version":"1.0","type":"link"}