{"product_id":"proteintech-12166-1-ap","title":"Proteintech, 12166-1-AP, Dysadherin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Dysadherin (12166-1-AP) by Proteintech is a Polyclonal antibody targeting Dysadherin in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n12166-1-AP targets Dysadherin in WB, IHC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue,  human placenta tissue\nPositive IHC detected in: human kidney tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDysadherin, also known as FXYD5 (FXYD domain containing ion transport regulator 5), \nis a cancer-associated cell membrane glycoprotein which belongs to the FXYD family. \nThe FXYD family, which contains seven members, are tissue specific regulators of the \nNa,K-ATPase. Dysadherin is involved in down-regulation of E-cadherin, which plays \n\nimportant roles in tumor development and metastasis. It is present in spleen, lung, \n\nskeletal muscle, and testis. Increased expression of dysadherin has been associated \n\nwith increased cell motility and metastatic potential.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2808 Product name: Recombinant human FXYD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-178 aa of BC009642 Sequence: KDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNHCR Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 5\nCalculated Molecular Weight: 178 aa, 19 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC009642\nGene Symbol: Dysadherin\nGene ID (NCBI): 53827\nRRID: AB_10640583\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DB9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965392553,"sku":"12166-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12166-1-ap","provider":"Iright","version":"1.0","type":"link"}