{"product_id":"proteintech-12191-1-ap","title":"Proteintech, 12191-1-AP, Endothelin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Endothelin 1 (12191-1-AP) by Proteintech is a Polyclonal antibody targeting Endothelin 1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n12191-1-AP targets Endothelin 1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: mouse lung tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEDN1, also named as Endothelin-1, PPET1 and ET-1, belongs to the endothelin\/sarafotoxin family. Endothelins are endothelium-derived vasoconstrictor peptides. Emerging basic science, and animal and human data all suggest that EDN1 is a potentially important contributor in the pathobiology of fibrosing disorders, including those that affect the lung(PMID:20055532 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2847 Product name: Recombinant human EDN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC009720 Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW Predict reactive species\nFull Name: endothelin 1\nCalculated Molecular Weight: 212 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC009720\nGene Symbol: Endothelin 1\nGene ID (NCBI): 1906\nRRID: AB_889392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05305\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864532649,"sku":"12191-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12191-1-ap","provider":"Iright","version":"1.0","type":"link"}