{"product_id":"proteintech-12211-1-ap","title":"Proteintech, 12211-1-AP, CPOX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPOX (12211-1-AP) by Proteintech is a Polyclonal antibody targeting CPOX in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12211-1-AP targets CPOX in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  Jurkat cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCPOX(Coproporphyrinogen-III oxidase, mitochondrial) is also named as CPO and CPX. Human CPO is a 76 kDa protein that is active as a homodimer in the mitochondrial intermembrane pace(PMID:16159891).Mutations in human CPO gene predict the clinical outcome of the disease, with either hepatic hereditary coproporphyria or hematological manifestations of erythropoietic harderoporphyria.CPOX has a transit peptide of 110 aa and the chain contains 344 aa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2858 Product name: Recombinant human CPOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC023551 Sequence: MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEA Predict reactive species\nFull Name: coproporphyrinogen oxidase\nCalculated Molecular Weight: 454 aa, 50 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC023551\nGene Symbol: CPOX\nGene ID (NCBI): 1371\nRRID: AB_2084233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36551\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964376745,"sku":"12211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12211-1-ap","provider":"Iright","version":"1.0","type":"link"}