{"product_id":"proteintech-12213-1-ap","title":"Proteintech, 12213-1-AP, MARCH5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARCH5 (12213-1-AP) by Proteintech is a Polyclonal antibody targeting MARCH5 in WB, IHC, ELISA applications with reactivity to human samples\n12213-1-AP targets MARCH5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U-937 cells\nPositive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARCH5(E3 ubiquitin-protein ligase MARCH5) is a 31 kDa protein also named as RNF153. This protein plays a protective role against mitochondrial dysfunction caused by the mitochondrial accumulation of mSOD1 via the ubiquitin-proteasome pathway (PMID:19741096). And it may regulate MAP1B LC1 function in mitochondria by controlling mitochondrial aggregation via mitochondrial LC1 levels(PMID:22308378). MEARCH5 can exsit as a homodimer with MW 65-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2806 Product name: Recombinant human MARCH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC015480 Sequence: MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRI Predict reactive species\nFull Name: membrane-associated ring finger (C3HC4) 5\nCalculated Molecular Weight: 278 aa, 31 kDa\nObserved Molecular Weight: 31 kDa, 65-70 kDa\nGenBank Accession Number: BC015480\nGene Symbol: MARCH5\nGene ID (NCBI): 54708\nRRID: AB_10638602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869471199401,"sku":"12213-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12213-1-ap","provider":"Iright","version":"1.0","type":"link"}