{"product_id":"proteintech-12226-1-ap","title":"Proteintech, 12226-1-AP, SH2B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH2B1 (12226-1-AP) by Proteintech is a Polyclonal antibody targeting SH2B1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n12226-1-AP targets SH2B1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human ovary cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH2B1 is a member of the SH2-domain containing mediators family. SH2B1 has been shown to interact with INS receptor, Grb2, TrkA and Janus kinase 2. Variations close to or in the SH2B1 gene have been found to associate with obesity in two large genome wide association studies of body mass index (PMID: 19079260). SH2B1deletions are associated with severe early-onset obesity (PMID: 19966786).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2863 Product name: Recombinant human SH2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC010704 Sequence: MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQ Predict reactive species\nFull Name: SH2B adaptor protein 1\nCalculated Molecular Weight: 426 aa, 45 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC010704\nGene Symbol: SH2B1\nGene ID (NCBI): 25970\nRRID: AB_2877838\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRF2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869598044329,"sku":"12226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12226-1-ap","provider":"Iright","version":"1.0","type":"link"}