{"product_id":"proteintech-12232-1-ap","title":"Proteintech, 12232-1-AP, PRKACB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRKACB (12232-1-AP) by Proteintech is a Polyclonal antibody targeting PRKACB in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12232-1-AP targets PRKACB in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  A549 cells,  HT-1080 cells,  mouse brain tissue,  mouse heart tissue,  PC-3 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human medulloblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRKACB, also named as PKA C-beta, belongs to the protein kinase superfamily. AGC Ser\/Thr protein kinase family and cAMP subfamily. It mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2870 Product name: Recombinant human PRKACB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC016285 Sequence: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF Predict reactive species\nFull Name: protein kinase, cAMP-dependent, catalytic, beta\nCalculated Molecular Weight: 41 kDa, 46 kDa\nObserved Molecular Weight: 36-55 kDa\nGenBank Accession Number: BC016285\nGene Symbol: PRKACB\nGene ID (NCBI): 5567\nRRID: AB_2170177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22694\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936032425,"sku":"12232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12232-1-ap","provider":"Iright","version":"1.0","type":"link"}