{"product_id":"proteintech-12235-1-ap","title":"Proteintech, 12235-1-AP, NR4A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR4A1 (12235-1-AP) by Proteintech is a Polyclonal antibody targeting NR4A1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12235-1-AP targets NR4A1 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, COLO 320 cells,  L02 cells,  mouse liver tissue,  rat liver tissue,  PC-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse colon tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNR4A1 is an orphan nuclear receptor that act concomitantly with NURR1 in regulating the expression of delay-early genes during liver regeneration. Also NR4A1 has linked not only to cell apoptosis but also proliferation in response to growth factor. It plays a role in caspase-independent cell death by activation of the ERK pathway and increased activity of MEF2 transcription factors. NR4A1 exists some isoforms with MW 65 and 34 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2875 Product name: Recombinant human NR4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-598 aa of BC016147 Sequence: KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF Predict reactive species\nFull Name: nuclear receptor subfamily 4, group A, member 1\nCalculated Molecular Weight: 598 aa, 64 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC016147\nGene Symbol: NR4A1\nGene ID (NCBI): 3164\nRRID: AB_10644125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848574633,"sku":"12235-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12235-1-ap","provider":"Iright","version":"1.0","type":"link"}