{"product_id":"proteintech-12246-1-ap","title":"Proteintech, 12246-1-AP, TAGLN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAGLN3 (12246-1-AP) by Proteintech is a Polyclonal antibody targeting TAGLN3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12246-1-AP targets TAGLN3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transgelin family is a group of proteins that belong to  22 kDa actin-related  corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated  neuronal cells. This antibody was generated against full length transgenlin 3 protein. It may cross-react with other two transgenlins based on the sequence similarity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2891 Product name: Recombinant human TAGLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC015329 Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM Predict reactive species\nFull Name: transgelin 3\nCalculated Molecular Weight: 22.4 kDa\nObserved Molecular Weight: 22.4 kDa\nGenBank Accession Number: BC015329\nGene Symbol: TAGLN3\nGene ID (NCBI): 29114\nRRID: AB_2199509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UI15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869775286441,"sku":"12246-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12246-1-ap","provider":"Iright","version":"1.0","type":"link"}