{"product_id":"proteintech-12247-1-ap","title":"Proteintech, 12247-1-AP, CHURC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHURC1 (12247-1-AP) by Proteintech is a Polyclonal antibody targeting CHURC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12247-1-AP targets CHURC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue, HeLa cells,  mouse liver tissue\nPositive IHC detected in: human brain tissue,  human gliomas tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHURC1 (churchill domain containing 1), also known as C14orf52 or chch. The function of CHURC1 has not been widely studied, and is yet to be fully elucidated. It may be a transcriptional activator that mediates FGF signaling during neural development.The MW of this protein is 13 kDa, and Catalog#12247-1-AP specially recognises the 13 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2892 Product name: Recombinant human CHURC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC020550 Sequence: MCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF Predict reactive species\nFull Name: churchill domain containing 1\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC020550\nGene Symbol: CHURC1\nGene ID (NCBI): 91612\nRRID: AB_10666204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUH1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886572228777,"sku":"12247-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12247-1-ap","provider":"Iright","version":"1.0","type":"link"}