{"product_id":"proteintech-12260-1-ap","title":"Proteintech, 12260-1-AP, SULF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULF2 (12260-1-AP) by Proteintech is a Polyclonal antibody targeting SULF2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12260-1-AP targets SULF2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human breast cancer tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULF2, also named as KIAA1247, belongs to the sulfatase family. It exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. SULF2 can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. SULF2 has several forms: the unglycosylated 100 kDa SULF2, the glycosylated 120-150 kDa SULF2, the cleaved 72-75 kDa and 50 kDa SULF2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2915 Product name: Recombinant human SULF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 722-870 aa of BC020962 Sequence: MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG Predict reactive species\nFull Name: sulfatase 2\nCalculated Molecular Weight: 870 aa, 96 kDa\nObserved Molecular Weight: 50 kDa, 130-150 kDa\nGenBank Accession Number: BC020962\nGene Symbol: SULF2\nGene ID (NCBI): 55959\nRRID: AB_11183762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609644201,"sku":"12260-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12260-1-ap","provider":"Iright","version":"1.0","type":"link"}