{"product_id":"proteintech-12268-1-ap","title":"Proteintech, 12268-1-AP, REG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REG4 (12268-1-AP) by Proteintech is a Polyclonal antibody targeting REG4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n12268-1-AP targets REG4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, SGC-7901 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nREG4 (Regenerating islet-derived protein 4) is a secreted C-type lectin that belongs to the regenerating gene (REG) family. Initially identified in a cDNA library from ulcerative colitis tissue, REG4 is predominantly expressed by intestinal enteroendocrine cells and is markedly up-regulated during gut inflammation and in various gastrointestinal cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2934 Product name: Recombinant human REG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-158 aa of BC017089 Sequence: VLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP Predict reactive species\nFull Name: regenerating islet-derived family, member 4\nCalculated Molecular Weight: 158 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC017089\nGene Symbol: REG4\nGene ID (NCBI): 83998\nRRID: AB_2178702\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYZ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869426962601,"sku":"12268-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12268-1-ap","provider":"Iright","version":"1.0","type":"link"}