{"product_id":"proteintech-12315-1-ap","title":"Proteintech, 12315-1-AP, CRB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRB3 (12315-1-AP) by Proteintech is a Polyclonal antibody targeting CRB3 in IHC, ELISA applications with reactivity to human samples\n12315-1-AP targets CRB3 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human pancreas tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCrumbs is an apical transmembrane protein crucial for epithelial morphogenesis in Drosophila melanogaster embryos. Three isoforms of mammalian Crumbs have been identified, and two have been characterized. Crumbs1 (CRB1) is expressed primarily in the central nervous system, whereas Crumbs3 (CRB3) is mainly expressed in epithelial tissues and skeletal muscles. CRB3 is an N-glycosylated, small transmembrane protein. CRB3 has a conserved cytoplasmic domain containing the two motives GTY and ERLI found in Crumbs, but exhibits a very short extracellular domain without the EGF- and laminin A-like G repeats present in the other Crumbs. Through its cytoplasmic domain and its interactors (e.g., Pals1 and Par6), CRB3 plays a role in apical membrane morphogenesis and tight junction regulation. (PMID: 14718572; 12527193; 15976445)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2968 Product name: Recombinant human CRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-123 aa of BC018409 Sequence: PFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI Predict reactive species\nFull Name: crumbs homolog 3 (Drosophila)\nCalculated Molecular Weight: 123 aa, 13 kDa\nGenBank Accession Number: BC018409\nGene Symbol: CRB3\nGene ID (NCBI): 92359\nRRID: AB_2877844\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886850330793,"sku":"12315-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12315-1-ap","provider":"Iright","version":"1.0","type":"link"}