{"product_id":"proteintech-12324-1-ap","title":"Proteintech, 12324-1-AP, TRIP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIP4 (12324-1-AP) by Proteintech is a Polyclonal antibody targeting TRIP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12324-1-AP targets TRIP4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells,  COLO 320 cells,  HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThyroid hormone receptor interactor 4(TRIP4), other named ASC1, is a transcriptional coactivator that promote transcriptional efficiencies. It harbors an autonomous transactivation domain that contains a putative zinc finger motif, which serves as a binding site for nuclear receptors for thyroid, estrogen, all-trans-retinoic acid and RXR by interaction with SRC-1 or CBP\/p300. There are two forms of ASC1 have been detected in mRNA level, isoform1(581aa, ~65kd) and isoform2(539aa,~60kd)(12077347,12390891)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2987 Product name: Recombinant human TRIP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-581 aa of BC012448 Sequence: QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV Predict reactive species\nFull Name: thyroid hormone receptor interactor 4\nCalculated Molecular Weight: 581 aa, 66 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC012448\nGene Symbol: TRIP4\nGene ID (NCBI): 9325\nRRID: AB_10646482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15650\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869781217449,"sku":"12324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12324-1-ap","provider":"Iright","version":"1.0","type":"link"}