{"product_id":"proteintech-12335-1-ap","title":"Proteintech, 12335-1-AP, CXCL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL1 (12335-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL1 in WB, IHC, ELISA applications with reactivity to human samples\n12335-1-AP targets CXCL1 in WB, IHC, IF, ELISA, Cell treatment applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LPS and Protein transport inhibitor treated HUVEC cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2917 Product name: Recombinant human CXCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC011976 Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)\nCalculated Molecular Weight: 8 kDa to 14 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC011976\nGene Symbol: CXCL1\nGene ID (NCBI): 2919\nRRID: AB_2087568\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09341\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832583849,"sku":"12335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12335-1-ap","provider":"Iright","version":"1.0","type":"link"}