{"product_id":"proteintech-12336-1-ap","title":"Proteintech, 12336-1-AP, FAM3D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM3D (12336-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3D in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12336-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, rat colon tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM3 (family with sequence similarity 3) is a cytokine-like family consisting of four members, FAM3A, FAM3B, FAM3C, and FAM3D, who share a 4-helical bundle structure. FAM3D is constitutively expressed in the gastrointestinal tract and is regulated by nutritional status. FAM3D controls blood sugar levels by acting as an insulin-sensitizing protein and improves lipid deposition in the liver. (PMID: 22226334; PMID: 37328068)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2965 Product name: Recombinant human FAM3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-204 aa of BC015359 Sequence: RSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTN Predict reactive species\nFull Name: family with sequence similarity 3, member D\nCalculated Molecular Weight: 224 aa, 24 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC015359\nGene Symbol: FAM3D\nGene ID (NCBI): 131177\nRRID: AB_10667402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BQ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869681569961,"sku":"12336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12336-1-ap","provider":"Iright","version":"1.0","type":"link"}