{"product_id":"proteintech-12347-1-ap","title":"Proteintech, 12347-1-AP, MAGOH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAGOH (12347-1-AP) by Proteintech is a Polyclonal antibody targeting MAGOH in WB, IHC, IP, ELISA applications with reactivity to human samples\n12347-1-AP targets MAGOH in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells,  HL-60 cells,  human brain tissue,  Raji cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAGOH, belonging to the mago nashi family, is a component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). MAGOH regulates the transcriptional activation of STAT3 by interfering complex formation between STAT3 and a core EJC component Y14.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3004 Product name: Recombinant human MAGOH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC018211 Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI Predict reactive species\nFull Name: mago-nashi homolog, proliferation-associated (Drosophila)\nCalculated Molecular Weight: 146 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC018211\nGene Symbol: MAGOH\nGene ID (NCBI): 4116\nRRID: AB_2265988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61326\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925710505,"sku":"12347-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12347-1-ap","provider":"Iright","version":"1.0","type":"link"}