{"product_id":"proteintech-12361-1-ap","title":"Proteintech, 12361-1-AP, Hemoglobin Epsilon Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Hemoglobin Epsilon (12361-1-AP) by Proteintech is a Polyclonal antibody targeting Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n12361-1-AP targets Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue,  K-562 cells,  mouse placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3026 Product name: Recombinant human HBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC015537 Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH Predict reactive species\nFull Name: hemoglobin, epsilon 1\nCalculated Molecular Weight: 147 aa, 16 kDa\nObserved Molecular Weight: 12-16 kDa\nGenBank Accession Number: BC015537\nGene Symbol: HBE1\nGene ID (NCBI): 3046\nRRID: AB_2114593\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02100\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868981448873,"sku":"12361-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12361-1-ap","provider":"Iright","version":"1.0","type":"link"}