{"product_id":"proteintech-12364-1-ap","title":"Proteintech, 12364-1-AP, UQCRH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UQCRH (12364-1-AP) by Proteintech is a Polyclonal antibody targeting UQCRH in IHC, ELISA applications with reactivity to human, mouse, rat samples\n12364-1-AP targets UQCRH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUQCRH(ubiquinol-cytochrome c reductase hinge protein) belongs to the UQCRH\/QCR6 family. It is a part of the mitochondrial respiratory chain that may mediate formation of the complex between cytochromes c and c1. The deduced 91-amino acid protein has a 13-amino acid N-terminal mitochondrial targeting presequence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3037 Product name: Recombinant human UQCRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC015177 Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase hinge protein\nCalculated Molecular Weight: 91 aa, 11 kDa\nGenBank Accession Number: BC015177\nGene Symbol: UQCRH\nGene ID (NCBI): 7388\nRRID: AB_2877850\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07919\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869785477289,"sku":"12364-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12364-1-ap","provider":"Iright","version":"1.0","type":"link"}