{"product_id":"proteintech-12365-1-ap","title":"Proteintech, 12365-1-AP, Cytochrome b5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytochrome b5 (12365-1-AP) by Proteintech is a Polyclonal antibody targeting Cytochrome b5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12365-1-AP targets Cytochrome b5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue\nPositive IHC detected in: human liver cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3038 Product name: Recombinant human Cytochrome b5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC015182 Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSS Predict reactive species\nFull Name: cytochrome b5 type A (microsomal)\nCalculated Molecular Weight: 134 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC015182\nGene Symbol: Cytochrome b5\nGene ID (NCBI): 1528\nRRID: AB_2089808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869670396073,"sku":"12365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12365-1-ap","provider":"Iright","version":"1.0","type":"link"}