{"product_id":"proteintech-12374-1-ap","title":"Proteintech, 12374-1-AP, SNX12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX12 (12374-1-AP) by Proteintech is a Polyclonal antibody targeting SNX12 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12374-1-AP targets SNX12 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNXs (sorting nexins) are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). SNXs are involved in endocytosis and protein trafficking. SNX12 (Sorting nexin 12) is localized in early endosomes and SNX12 overexpression specifically prevents the degradative pathway from early to late endosomes\/lysosomes (PMID: 22719997). SNX12 may participate in Alzheimer's disease (AD) pathology by regulating the endocytosis of BACE1 and affecting β-processing of APP (PMID: 22709416).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3014 Product name: Recombinant human SNX12 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-162 aa of BC020559 Sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLA Predict reactive species\nFull Name: sorting nexin 12\nCalculated Molecular Weight: 172 aa, 20 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC020559\nGene Symbol: SNX12\nGene ID (NCBI): 29934\nRRID: AB_3085392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887811285161,"sku":"12374-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12374-1-ap","provider":"Iright","version":"1.0","type":"link"}