{"product_id":"proteintech-12390-1-ap","title":"Proteintech, 12390-1-AP, BEX1\/2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BEX1\/2 (12390-1-AP) by Proteintech is a Polyclonal antibody targeting BEX1\/2 in WB, IHC, ELISA applications with reactivity to human samples\n12390-1-AP targets BEX1\/2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IHC detected in: human medulloblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBEX1 is a signaling adapter molecule involved in p75NTR\/NGFR signaling. It lays a role in cell cycle progression and neuronal differentiation. BEX1 inhibits neuronal differentiation in response to nerve growth factor (NGF). BEX2 is a regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. It regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. The homology between human BEX1 and BEX2 is 94%. This antibody detects both BEX1 and BEX2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3066 Product name: Recombinant human BEX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC015522 Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP Predict reactive species\nFull Name: brain expressed X-linked 2\nCalculated Molecular Weight: 128 aa, 15 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC015522\nGene Symbol: BEX2\nGene ID (NCBI): 84707\nRRID: AB_10644326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977483945,"sku":"12390-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12390-1-ap","provider":"Iright","version":"1.0","type":"link"}