{"product_id":"proteintech-12396-1-ap","title":"Proteintech, 12396-1-AP, RGS13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS13 (12396-1-AP) by Proteintech is a Polyclonal antibody targeting RGS13 in IHC, IP, ELISA applications with reactivity to human samples\n12396-1-AP targets RGS13 in IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Ramos cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegulator of G-protein signaling 13 (RGS13) is an R4 subfamily member that attenuates both Gαi and Gαq-dependent signaling including chemokine reponses in B cells (PMID: 11875076, PMID: 12193720). RGS13 interacted with both Gialpha and Gqalpha and strongly impaired signaling through G(i)-linked signaling pathways, including signaling through the chemokine receptors CXCR4 and CXCR5 (PMID: 12193720). Human mast cells express multiple RGS proteins, of which RGS13 is among the most abundant (PMID: 19017978).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3077 Product name: Recombinant human RGS13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC016667 Sequence: MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF Predict reactive species\nFull Name: regulator of G-protein signaling 13\nCalculated Molecular Weight: 159 aa, 19 kDa\nObserved Molecular Weight: 17-19 kDa\nGenBank Accession Number: BC016667\nGene Symbol: RGS13\nGene ID (NCBI): 6003\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14921\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887783989417,"sku":"12396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12396-1-ap","provider":"Iright","version":"1.0","type":"link"}