{"product_id":"proteintech-12472-1-ap","title":"Proteintech, 12472-1-AP, MOBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOBP (12472-1-AP) by Proteintech is a Polyclonal antibody targeting MOBP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12472-1-AP targets MOBP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:600\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3156 Product name: Recombinant human MOBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC022471 Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL Predict reactive species\nFull Name: myelin-associated oligodendrocyte basic protein\nCalculated Molecular Weight: 183 aa, 21 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC022471\nGene Symbol: MOBP\nGene ID (NCBI): 4336\nRRID: AB_10644161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869473329321,"sku":"12472-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12472-1-ap","provider":"Iright","version":"1.0","type":"link"}