{"product_id":"proteintech-12478-1-ap","title":"Proteintech, 12478-1-AP, PREPL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PREPL (12478-1-AP) by Proteintech is a Polyclonal antibody targeting PREPL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12478-1-AP targets PREPL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPREPL (Prolyl endopeptidase-like) is also named as KIAA0436 and belongs to the prolyl oligopeptidase subfamily of serine peptidases. IPREPL is a novel oligopeptidase with unique structural and functional characteristics (PMID:16385448). It has 4 isoforms produced by alternative splicing and can exsit as a homodimer (PMID:16143824). Defects in PREPL are a cause of hypotonia-cystinuria syndrome (HCS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3196 Product name: Recombinant human PREPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC013193 Sequence: MDLKMNFRPERRVLVDDGWILAYCHVRYGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF Predict reactive species\nFull Name: prolyl endopeptidase-like\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC013193\nGene Symbol: PREPL\nGene ID (NCBI): 9581\nRRID: AB_2300040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4J6C6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887773012137,"sku":"12478-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12478-1-ap","provider":"Iright","version":"1.0","type":"link"}