{"product_id":"proteintech-12480-1-ap","title":"Proteintech, 12480-1-AP, Ephrin A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ephrin A3 (12480-1-AP) by Proteintech is a Polyclonal antibody targeting Ephrin A3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n12480-1-AP targets Ephrin A3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IP detected in: A549 cells\nPositive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3188 Product name: Recombinant human EFNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-222 aa of BC017722 Sequence: LGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHL Predict reactive species\nFull Name: ephrin-A3\nCalculated Molecular Weight: 238 aa, 26 kDa\nObserved Molecular Weight: 26-35 kDa\nGenBank Accession Number: BC017722\nGene Symbol: Ephrin A3\nGene ID (NCBI): 1944\nRRID: AB_10638305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980072617,"sku":"12480-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12480-1-ap","provider":"Iright","version":"1.0","type":"link"}