{"product_id":"proteintech-12495-1-ap","title":"Proteintech, 12495-1-AP, Mu Crystallin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mu Crystallin (12495-1-AP) by Proteintech is a Polyclonal antibody targeting Mu Crystallin in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n12495-1-AP targets Mu Crystallin in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, Jurkat cells,  human kidney tissue,  human heart tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human gliomas tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nmu Crystallin(thiomorpholine-carboxylate dehydrogenase) is also named as THBP, CRYM, ketimine reductase and belongs to the ornithine cyclodeaminase family. This protein catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). It is also involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3161 Product name: Recombinant human CRYM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC018061 Sequence: MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK Predict reactive species\nFull Name: crystallin, mu\nCalculated Molecular Weight: 314 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC018061\nGene Symbol: Mu Crystallin\nGene ID (NCBI): 1428\nRRID: AB_2084620\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14894\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869474345129,"sku":"12495-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12495-1-ap","provider":"Iright","version":"1.0","type":"link"}