{"product_id":"proteintech-12515-1-ap","title":"Proteintech, 12515-1-AP, NUFIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUFIP1 (12515-1-AP) by Proteintech is a Polyclonal antibody targeting NUFIP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n12515-1-AP targets NUFIP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A375 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFragile X syndrome, the most common cause of inherited mental retardation, is caused by the absence of FMRP (Fragile X Mental Retardation Protein). FMRP is an RNA binding protein reported to be involved in translational control, notably at postsynaptic sites of protein synthesis as a part of a multiprotein\/mRNA complex[PMID:12941608]. NUFIP1 is one of the several FMRP-interacting proteins. NUFIP can act as a pol II-specific basal transcriptional activator in vitro and when ectopically overexpressed in vivo. NUFIP can directly activate promoters by enhancing the ATP-dependent release of hyperphosphorylated form of pol II from open transcription complexes[PMID:15107825].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3197 Product name: Recombinant human NUFIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC017745 Sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV Predict reactive species\nFull Name: nuclear fragile X mental retardation protein interacting protein 1\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC017745\nGene Symbol: NUFIP1\nGene ID (NCBI): 26747\nRRID: AB_2298759\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898414761,"sku":"12515-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12515-1-ap","provider":"Iright","version":"1.0","type":"link"}