{"product_id":"proteintech-12525-1-ap","title":"Proteintech, 12525-1-AP, IRF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF2 (12525-1-AP) by Proteintech is a Polyclonal antibody targeting IRF2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12525-1-AP targets IRF2 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, COLO 320 cells,  Jurkat cells,  mouse colon tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF2, also known as IFN regulatory factor 2, which belongs to the IRF family. IRF2 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)) and represses those genes. IRF2 also acts as an activator for several genes including H4 and IL7. IRF2 constitutively binds to the ISRE promoter to activate IL7. IRF2 is involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. The calculated molecular weight of IRF2 is 39 kDa, but post-modification of IRF2 is about 50 kDa (PMID: 17698501).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3220 Product name: Recombinant human IRF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC015803 Sequence: MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC Predict reactive species\nFull Name: IRF 2\nCalculated Molecular Weight: 349 aa, 39 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC015803\nGene Symbol: IRF2\nGene ID (NCBI): 3660\nRRID: AB_2296127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14316\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868942028969,"sku":"12525-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12525-1-ap","provider":"Iright","version":"1.0","type":"link"}