{"product_id":"proteintech-12540-1-ap","title":"Proteintech, 12540-1-AP, Amylase Alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Amylase Alpha (12540-1-AP) by Proteintech is a Polyclonal antibody targeting Amylase Alpha in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n12540-1-AP targets Amylase Alpha in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3260 Product name: Recombinant human AMY2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 160-511 aa of BC011179 Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species\nFull Name: amylase, alpha 2B (pancreatic)\nCalculated Molecular Weight: 511 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC011179\nGene Symbol: AMY2B\nGene ID (NCBI): 280\nRRID: AB_2273990\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19961\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880883881,"sku":"12540-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12540-1-ap","provider":"Iright","version":"1.0","type":"link"}