{"product_id":"proteintech-12557-1-ap","title":"Proteintech, 12557-1-AP, PRMT8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRMT8 (12557-1-AP) by Proteintech is a Polyclonal antibody targeting PRMT8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12557-1-AP targets PRMT8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells\nPositive IHC detected in: rat brain tissue, human breast cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRMT8 is a member of arginine methyl transferase (PRMT) family which acts as nuclear receptor coactivators. PRMT8 catalyzes the asymmetric arginine methylation and is involved in cellular differentiation. PRMT8 has several isoforms; the full-length isoform has a brain specific expression pattern and is localized to the plasma membrane; the truncated isoforms display nuclear localization and are expressed more widely. This antibody recognizes all of isoforms of PRMT8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3166 Product name: Recombinant human PRMT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-394 aa of BC022458 Sequence: RTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR Predict reactive species\nFull Name: protein arginine methyltransferase 8\nCalculated Molecular Weight: 394 aa, 45 kDa\nObserved Molecular Weight: 43-50 kDa\nGenBank Accession Number: BC022458\nGene Symbol: PRMT8\nGene ID (NCBI): 56341\nRRID: AB_2171964\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NR22\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869490827433,"sku":"12557-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12557-1-ap","provider":"Iright","version":"1.0","type":"link"}