{"product_id":"proteintech-12559-1-ap","title":"Proteintech, 12559-1-AP, STK36 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK36 (12559-1-AP) by Proteintech is a Polyclonal antibody targeting STK36 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12559-1-AP targets STK36 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTK36(Serine\/threonine-protein kinase 36) is also named as KIAA1278 and belongs to the Ser\/Thr protein kinase family. The Serine\/threonine protein kinase plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors and controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3279 Product name: Recombinant human STK36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-304 aa of BC026158 Sequence: KYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKDFLQGLLTKDPRQRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILTQ Predict reactive species\nFull Name: serine\/threonine kinase 36, fused homolog (Drosophila)\nCalculated Molecular Weight: 1315 aa, 144 kDa\nObserved Molecular Weight: 144 kDa\nGenBank Accession Number: BC026158\nGene Symbol: STK36\nGene ID (NCBI): 27148\nRRID: AB_2196785\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869501640873,"sku":"12559-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12559-1-ap","provider":"Iright","version":"1.0","type":"link"}