{"product_id":"proteintech-12561-1-ap","title":"Proteintech, 12561-1-AP, SELK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SELK (12561-1-AP) by Proteintech is a Polyclonal antibody targeting SELK in WB, ELISA applications with reactivity to human, mouse, rat samples\n12561-1-AP targets SELK in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSelenoprotein K (SelK), a single-pass transmembrane protein that resides in the endoplasmic reticulum (ER) membrane, which has been reported to an emerging role of playing a part in protein palmitoylation. Human SelK is a 94-amino-acid protein with Sec residing at the penultimate position. It has been shown that SelK is expressed predominantly in the heart and skeletal muscle, but other tissues, such as the liver, pancreas, and placenta, also have detectable levels of SelK.(PMID: 36252341)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3143 Product name: Recombinant human SELK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC013162 Sequence: MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG Predict reactive species\nFull Name: selenoprotein K\nCalculated Molecular Weight: 94 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC013162\nGene Symbol: SELK\nGene ID (NCBI): 58515\nRRID: AB_2186964\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6D0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869429452969,"sku":"12561-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12561-1-ap","provider":"Iright","version":"1.0","type":"link"}