{"product_id":"proteintech-12562-1-ap","title":"Proteintech, 12562-1-AP, AK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AK3 (12562-1-AP) by Proteintech is a Polyclonal antibody targeting AK3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12562-1-AP targets AK3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Y79 cells,  L02 cells,  mouse heart tissue,  mouse kidney tissue,  rat heart tissue,  rat kidney\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human pancreas cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAK3(Adenylate kinase 3) is also named as AK3L1, AK6, AKL3L and belongs to the adenylate kinase family. It is located in the mitochondrial matrix and is a GTP:AMP phosphotransferase(PMID:2546792). AK3 can be detected AK3 at an apparent molecular mass of 28 kD by western blot analysis and subcellular fractionation of mouse liver and kidney detected Ak3 in the mitochondrial fraction(PMID:11485571). This antibody may also recognize AK4 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3146 Product name: Recombinant human AK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC013771 Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP Predict reactive species\nFull Name: adenylate kinase 3\nCalculated Molecular Weight: 227 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC013771\nGene Symbol: AK3\nGene ID (NCBI): 50808\nRRID: AB_2305373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UIJ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869512978601,"sku":"12562-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12562-1-ap","provider":"Iright","version":"1.0","type":"link"}