{"product_id":"proteintech-12578-1-ap","title":"Proteintech, 12578-1-AP, SULT4A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULT4A1 (12578-1-AP) by Proteintech is a Polyclonal antibody targeting SULT4A1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n12578-1-AP targets SULT4A1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULT4A1, also named as SULTX3, NST, ST4A1, hBR-STL and hBR-STL-1, belongs to the sulfotransferase 1 family. It may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT4A1 displays activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphtylamine, and 2-naphtol. It may have a role in the sulfation of drugs and neurotransmitters in the CNS. SULT4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. It is a novel cytosolic sulfotransferase that is primarily expressed in the brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3271 Product name: Recombinant human SULT4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-284 aa of BC022459 Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL Predict reactive species\nFull Name: sulfotransferase family 4A, member 1\nCalculated Molecular Weight: 284 aa, 33 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC022459\nGene Symbol: SULT4A1\nGene ID (NCBI): 25830\nRRID: AB_2197933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BR01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904214697,"sku":"12578-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12578-1-ap","provider":"Iright","version":"1.0","type":"link"}