{"product_id":"proteintech-12592-1-ap","title":"Proteintech, 12592-1-AP, FDX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FDX1 (12592-1-AP) by Proteintech is a Polyclonal antibody targeting FDX1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12592-1-AP targets FDX1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HepG2 cells,  PC-3 cells,  mouse testis tissue\nPositive IHC detected in: human kidney tissue, human liver tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin\/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3301 Product name: Recombinant human FDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC017063 Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species\nFull Name: ferredoxin 1\nCalculated Molecular Weight: 184 aa, 19 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC017063\nGene Symbol: FDX1\nGene ID (NCBI): 2230\nRRID: AB_11182486\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10109\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827865257,"sku":"12592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12592-1-ap","provider":"Iright","version":"1.0","type":"link"}