{"product_id":"proteintech-12595-1-ap","title":"Proteintech, 12595-1-AP, PANX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PANX1 (12595-1-AP) by Proteintech is a Polyclonal antibody targeting PANX1 in WB, ELISA applications with reactivity to human, mouse samples\n12595-1-AP targets PANX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, SH-SY5Y cells,  K-562 cells,  MDA-MB-231 cells,  C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal\/nucleotide release from apoptotic cells. Western blot for Panx1 was also seen in two bands at 45~50 kDa and ~90 kDa. The band of ~90 kDa corresponding to the Panx1 dimer size. (PMID: 24590064, PMID: 19009624)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3174 Product name: Recombinant human PANX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-426 aa of BC016931 Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC Predict reactive species\nFull Name: pannexin 1\nCalculated Molecular Weight: 426 aa, 48 kDa\nObserved Molecular Weight: 45-50 kDa, 90 kDa\nGenBank Accession Number: BC016931\nGene Symbol: PANX1\nGene ID (NCBI): 24145\nRRID: AB_2159186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RD7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879966377,"sku":"12595-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12595-1-ap","provider":"Iright","version":"1.0","type":"link"}