{"product_id":"proteintech-12604-1-ap","title":"Proteintech, 12604-1-AP, IFIT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFIT2 (12604-1-AP) by Proteintech is a Polyclonal antibody targeting IFIT2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n12604-1-AP targets IFIT2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, THP-1 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFIT2 belongs to the IFIT family. It contains 6 TPR repeats. IFIT genes comprise a large family with three (Ifit1, Ifit2, and Ifit3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT proteins are produced in human body that are supposed to confer immunity against viral infection. These proteins are generally produced during viral infection, IFN treatment, and during pathogen recognition (Pathogen associated molecular pattern recognition) by immune system during infections.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3283 Product name: Recombinant human IFIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-399 aa of BC032839 Sequence: ATMCNLLAYLKHLKGQNEAALECLRKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVRHVCEKFSSPYRIESPELDCEEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQYLKVLLALKLHKMREEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGV Predict reactive species\nFull Name: IFIT 2\nCalculated Molecular Weight: 484 aa, 56 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC032839\nGene Symbol: IFIT2\nGene ID (NCBI): 3433\nRRID: AB_2864734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09913\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842512553,"sku":"12604-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12604-1-ap","provider":"Iright","version":"1.0","type":"link"}