{"product_id":"proteintech-12605-1-ap","title":"Proteintech, 12605-1-AP, GUCY1A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GUCY1A3 (12605-1-AP) by Proteintech is a Polyclonal antibody targeting GUCY1A3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12605-1-AP targets GUCY1A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human cerebellum tissue,  human kidney tissue,  mouse lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanylate cyclase soluble subunit alpha-1 (GUCY1A3, also known as GUCY1A1, GCS-alpha-1, and GCS-alpha-3) is a lyase that plays a role in cGMP biosynthesis (PMID: 24155296). GUCY1A3 activation may be considered as a strategy to alleviate endothelial ferroptosis and cardiac microvascular reperfusion injury (PMID: 40856046). GUCY1A3 is also known to be associated with coronary artery disease and pulmonary artery hypertension (PMID: 24213632; 25373139).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3293 Product name: Recombinant human GUCY1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-690 aa of BC028384 Sequence: EDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID Predict reactive species\nFull Name: guanylate cyclase 1, soluble, alpha 3\nCalculated Molecular Weight: 690 aa, 77 kDa\nObserved Molecular Weight: 77 kDa\nGenBank Accession Number: BC028384\nGene Symbol: GUCY1A3\nGene ID (NCBI): 2982\nRRID: AB_2248099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02108\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934033577,"sku":"12605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12605-1-ap","provider":"Iright","version":"1.0","type":"link"}